SPDYA Rabbit Polyclonal Antibody

CAT#: TA333383

Rabbit Polyclonal Anti-SPDYA Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "SPDYA"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-SPDYA Antibody: synthetic peptide directed towards the middle region of human SPDYA. Synthetic peptide located within the following region: HTAGVTEKHSQDSYNSLSMDIIGDPSQAYTGSEVVNDHQSNKGKKTNFLK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 36 kDa
Gene Name speedy/RINGO cell cycle regulator family member A
Background SPDYA regulates the G1/S phase transition of the cell cycle by binding and activating CDC2, CDK2 and CDKN1B/KIP1. SPDYA can activate CDK2 without promoting CDK2 phosphorylation. SPDYA mediates cell survival during the DNA damage process through activation of CDK2.
Synonyms RINGO3; RINGOA; SPDY1; SPY1
Note Immunogen sequence homology: Human: 100%
Reference Data
Protein Pathways Oocyte meiosis, Progesterone-mediated oocyte maturation

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.