UTY Rabbit Polyclonal Antibody

CAT#: TA333386

Rabbit Polyclonal Anti-UTY Antibody

Product Images

Host: Rabbit; Target Name: UTY; Sample Tissue: Thyroid Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-UTY Antibody is: synthetic peptide directed towards the N-terminal region of Human UTY. Synthetic peptide located within the following region: NLLLEDYSKALSAYQRYYSLQADYWKNAAFLYGLGLVYFYYNAFHWAIKA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 118 kDa
• Gene Name: ubiquitously transcribed tetratricopeptide repeat containing, Y-linked
• Database Link:
  NP_872601
  Entrez Gene 7404 Human
  UniProt ID O14607
• Background: This gene encodes a protein containing tetratricopeptide repeats which are thought to be involved in protein-protein interactions. This protein is a minor histocompatibility antigen which may induce graft rejection of male stem cell grafts. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Synonyms: KDM6AL; UTY1
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Transmembrane