COL6A5 Rabbit Polyclonal Antibody

CAT#: TA333468

Rabbit Polyclonal Anti-COL6A5 Antibody

Product Images

Host: Rabbit; Target Name: COL6A5; Sample Tissue: Fetal Heart lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-COL6A5 Antibody is: synthetic peptide directed towards the C-terminal region of Human COL6A5. Synthetic peptide located within the following region: RNVSLRAKCQGYSIFVFSFGPKHNDKELEELASHPLDHHLVQLGRTHKPD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: collagen type VI alpha 5
• Database Link:
  NP_694996
  Entrez Gene 256076 Human
  UniProt ID A8TX70
• Background: The protein encoded by this gene is a collagen that contains N- and C-terminal von Willebrand factor A-like domains. The encoded protein may interact with the alpha 1 and alpha 2 chains of collagen VI to form the complete collagen VI trimer. Sequence polymorphisms in this gene have been linked to atopic dermatitis (eczema). Two transcript variants, one protein-coding and the other probably not protein-coding, have been found for this gene.
• Synonyms: COL29A1; VWA4
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Rat: 86%; Mouse: 86%; Rabbit: 79%