ZNF750 Rabbit Polyclonal Antibody

CAT#: TA333668

Rabbit Polyclonal Anti-ZNF750 Antibody

Product Images

WB Suggested Anti-ZINC FINGER PROTEIN 750 Antibody Titration: 5 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZINC FINGER PROTEIN 750 Antibody: synthetic peptide directed towards the middle region of human ZINC FINGER PROTEIN 750. Synthetic peptide located within the following region: NRKHVEFESPIPEAKDSSKAGQRDTEGSKMSPRAGSAATGSPGRPSPTDF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 77 kDa
• Gene Name: zinc finger protein 750
• Database Link:
  NP_078978
  Entrez Gene 79755 Human
  UniProt ID Q32MQ0
• Background: Zinc finger protein 750 is a new candidate transcription factor
• Synonyms: ZFP750
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%