SLC25A22 Rabbit Polyclonal Antibody

CAT#: TA333670

Rabbit Polyclonal Anti-SLC25A22 Antibody

Product Images

WB Suggested Anti-SLC25A22 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC25A22 Antibody: synthetic peptide directed towards the N terminal of human SLC25A22. Synthetic peptide located within the following region: VNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: solute carrier family 25 member 22
• Database Link:
  NP_078974
  Entrez Gene 79751 Human
  UniProt ID Q9H936
• Background: The SLC25 family is mitochondrial carriers that transport a variety of metabolites across the inner mitochondrial membrane. SLC25A22, also known as GC1, is 1 of the 2 mitochondrial glutamate/H+ symporters, the other being SLC25A18.
• Synonyms: EIEE3; GC-1; GC1; NET44
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 86%; Zebrafish: 86%

Reference Data

• Protein Families: Transmembrane