SLC22A11 Rabbit Polyclonal Antibody

CAT#: TA333749

Rabbit Polyclonal Anti-SLC22A11 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "SLC22A11"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-SLC22A11 Antibody: synthetic peptide directed towards the N terminal of human SLC22A11. Synthetic peptide located within the following region: MAFSKLLEQAGGVGLFQTLQVLTFILPCLMIPSQMLLENFSAAIPGHRCW
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 60 kDa
Gene Name solute carrier family 22 member 11
Background SLC22A11 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. SLC22A11 is an integral membrane protein and is found mainly in the kidney and in the placenta, where it may act to prevent potentially harmful organic anions from reaching the fetus.The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and is found mainly in the kidney and in the placenta, where it may act to prevent potentially harmful organic anions from reaching the fetus. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms hOAT4; OAT4
Note Immunogen sequence homology: Human: 100%; Bovine: 100%; Rat: 83%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.