SLC22A11 Rabbit Polyclonal Antibody

CAT#: TA333749

Rabbit Polyclonal Anti-SLC22A11 Antibody

Product Images

WB Suggested Anti-SLC22A11 Antibody Titration: 1.25 ug/ml; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC22A11 Antibody: synthetic peptide directed towards the N terminal of human SLC22A11. Synthetic peptide located within the following region: MAFSKLLEQAGGVGLFQTLQVLTFILPCLMIPSQMLLENFSAAIPGHRCW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: solute carrier family 22 member 11
• Database Link:
  NP_060954
  Entrez Gene 55867 Human
  UniProt ID Q9NSA0
• Background: SLC22A11 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. SLC22A11 is an integral membrane protein and is found mainly in the kidney and in the placenta, where it may act to prevent potentially harmful organic anions from reaching the fetus.The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and is found mainly in the kidney and in the placenta, where it may act to prevent potentially harmful organic anions from reaching the fetus. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: hOAT4; OAT4
• Note: Immunogen sequence homology: Human: 100%; Bovine: 100%; Rat: 83%

Reference Data

• Protein Families: Transmembrane