UBF1 (UBTF) Rabbit Polyclonal Antibody

CAT#: TA333872

Rabbit Polyclonal Anti-UBTF Antibody

Product Images

WB Suggested Anti-UBTF Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:2500; Positive Control: Hela cell lysateUBTF is supported by BioGPS gene expression data to be expressed in HeLa

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-UBTF Antibody: synthetic peptide directed towards the middle region of human UBTF. Synthetic peptide located within the following region: LESLPEEEQQRVLGEEKMLNINKKQATSPASKKPAQEGGKGGSEKPKRPV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 89 kDa
• Gene Name: upstream binding transcription factor, RNA polymerase I
• Database Link:
  NP_055048
  Entrez Gene 7343 Human
  UniProt ID P17480
• Background: UBTF is a transcription factor required for expression of the 18S, 5.8S, and 28S ribosomal RNAs, along with SL1. Two UBTF polypeptides, of 94 and 97 kD, exist in the human. UBTF is a nucleolar phosphoprotein with both DNA binding and transactivation domains. Sequence-specific DNA binding to the core and upstream control elements of the human rRNA promoter is mediated through several HMG boxesUpstream binding factor (UBF) is a transcription factor required for expression of the 18S, 5.8S, and 28S ribosomal RNAs, along with SL1 (a complex of TBP (MIM 600075) and multiple TBP-associated factors or 'TAFs'). Two UBF polypeptides, of 94 and 97 kD, exist in the human (Bell et al., 1988 [PubMed 3413483]). UBF is a nucleolar phosphoprotein with both DNA binding and transactivation domains. Sequence-specific DNA binding to the core and upstream control elements of the human rRNA promoter is mediated through several HMG boxes (Jantzen et al., 1990 [PubMed 2330041]). [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: NOR-90; UBF; UBF-1; UBF1; UBF2
• Note: Immunogen sequence homology: Human: 100%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Pig: 86%; Bovine: 86%; Guinea pig: 79%; Horse: 77%

Reference Data

• Protein Families: Transcription Factors