SLC33A1 Rabbit Polyclonal Antibody

CAT#: TA333961

Rabbit Polyclonal Anti-SLC33A1 Antibody

Product Images

WB Suggested Anti-SLC33A1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Placenta

• 

  2Hum. Fetal Brain; Host: Rabbit; Target Name: NOP56; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

• 

  3Human HeLa; Host: Rabbit; Target Name: EGFL8; Sample Tissue: Hela; Antibody Dilution: 1.0 ug/ml;SLC33A1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells

• 

  4Human 721_B; Host: Rabbit; Target Name: WT1; Sample Tissue: 721_B; Antibody Dilution: 1.0 ug/ml;SLC33A1 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC33A1 Antibody: synthetic peptide directed towards the middle region of human SLC33A1. Synthetic peptide located within the following region: CNSVGQTAGYFLGNVLFLALESADFCNKYLRFQPQPRGIVTLSDFLFFWG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: solute carrier family 33 member 1
• Database Link:
  NP_004724
  Entrez Gene 9197 Human
  UniProt ID O00400
• Background: SLC33A1 is required for the formation of O-acetylated (Ac) gangliosides. It is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Studies indicate that the protein is localized to the cytoplasm.The encoded protein is required for the formation of O-acetylated (Ac) gangliosides. It is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Studies indicate that the protein is localized to the cytoplasm.
• Synonyms: ACATN; AT-1; AT1; CCHLND; SPG42
• Note: Immunogen sequence homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 86%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Glycosphingolipid biosynthesis - ganglio series, Metabolic pathways