TEAD3 Rabbit Polyclonal Antibody

CAT#: TA334023

Rabbit Polyclonal Anti-TEAD3 Antibody

Product Images

WB Suggested Anti-TEAD3 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TEAD3 Antibody: synthetic peptide directed towards the middle region of human TEAD3. Synthetic peptide located within the following region: GLKELYEKGPPNAFFLVKFWADLNSTIQEGPGAFYGVSSQYSSADSMTIS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: TEA domain transcription factor 3
• Database Link:
  NP_003205
  Entrez Gene 7005 Human
  UniProt ID Q99594
• Background: TEAD3 is a member of the transcriptional enhancer factor (TEF) family. The family members contain the TEA/ATTS DNA-binding domain. This member is preferentially expressed in placenta and transactivates the chorionic somatomammotropin gene enhancer.This gene encodes a member of the transcriptional enhancer factor (TEF) family. The family members contain the TEA/ATTS DNA-binding domain. This member is preferentially expressed in placenta and transactivates the chorionic somatomammotropin gene enhancer. The protein is encoded through the use of a non-AUG (ATA) translation initiation codon.
• Synonyms: DTEF-1; ETFR-1; TEAD-3; TEAD5; TEF-5; TEF5
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 77%

Reference Data

• Protein Families: Transcription Factors