SYCE2 Rabbit Polyclonal Antibody

CAT#: TA334098

Rabbit Polyclonal Anti-SYCE2 Antibody

Product Images

WB Suggested Anti-SYCE2 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SYCE2 Antibody is: synthetic peptide directed towards the C-terminal region of Human SYCE2. Synthetic peptide located within the following region: LKQVCHSVETVYKDLCLQPEQSLRLRWGPDHSRGKSPPRPGNSQPPDVFV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: synaptonemal complex central element protein 2
• Database Link:
  NP_001099048
  Entrez Gene 256126 Human
  UniProt ID Q6PIF2
• Background: SYCE2 is a major component of the transverse central element of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. SYCE2 requires SYCP1 in order to be incorporated into the central element and may have a role in the synaptonemal complex assembly, stabilization and recombination.
• Synonyms: CESC1
• Note: Immunogen sequence homology: Human: 100%