C9orf116 Rabbit Polyclonal Antibody

CAT#: TA334124

Rabbit Polyclonal Anti-C9orf116 Antibody

Product Images

Host: Rabbit; Target Name: C9orf116; Sample Tissue: Placenta lysates; Antibody Dilution: 1.0 ug/ml.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-C9orf116 Antibody is: synthetic peptide directed towards the N-terminal region of Human C9orf116. Synthetic peptide located within the following region: NNPGWFRGYRTQKAVSVYRTSNQAYGSRAPTVHEMPKVFYPNSNKFSQQL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 14 kDa
• Gene Name: chromosome 9 open reading frame 116
• Database Link:
  NP_001041730
  Entrez Gene 138162 Human
  UniProt ID Q5BN46
• Background: The function of this protein remains unknown.
• Synonyms: PIERCE1; RbEST47
• Note: Immunogen sequence homology: Pig: 100%; Human: 100%; Bovine: 100%; Zebrafish: 90%; Rat: 86%; Mouse: 86%; Guinea pig: 79%