ARHGAP11B Rabbit Polyclonal Antibody

CAT#: TA334130

Rabbit Polyclonal Anti-ARHGAP11B Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ARHGAP11B"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ARHGAP11B Antibody is: synthetic peptide directed towards the C-terminal region of Human ARHGAP11B. Synthetic peptide located within the following region: MDSSNLAVIFAPNLLQTSEGHEKMSSNAEKKGVYQTLSWKRYQPCWVLMV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 29 kDa
Gene Name Rho GTPase activating protein 11B
Background The function of this protein remains unknown.
Synonyms B'-T; B -T; FAM7B1
Note Immunogen sequence homology: Human: 100%; Pig: 85%; Rat: 85%; Horse: 85%; Mouse: 85%; Bovine: 85%; Guinea pig: 85%; Rabbit: 83%; Dog: 77%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.