TBX5 Rabbit Polyclonal Antibody

CAT#: TA334175

Rabbit Polyclonal Anti-TBX5 Antibody

Product Images

WB Suggested Anti-TBX5 Antibody; Titration: 5 ug/ml; Positive Control: HepG2 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TBX5 Antibody: synthetic peptide directed towards the N terminal of human TBX5. Synthetic peptide located within the following region: NSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKIT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: T-box 5
• Database Link:
  NP_000183
  Entrez Gene 6910 Human
  UniProt ID Q99593
• Background: TBX5 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is closely linked to related family member T-box 3 (ulnar mammary syndrome) on human chromosome 12. The encoded protein may play a role in heart development and specification of limb identity. Mutations in this gene have been associated with Holt-Oram syndrome, a developmental disorder affecting the heart and upper limbs. Several transcript variants encoding different isoforms have been described for this gene.
• Synonyms: HOS
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors