Mortality Factor 4 like 2 (MORF4L2) Rabbit Polyclonal Antibody

CAT#: TA334235

Rabbit Polyclonal Anti-MORF4L2 Antibody

Product Images

WB Suggested Anti-MORF4L2 Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysate

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MORF4L2 antibody: synthetic peptide directed towards the N terminal of human MORF4L2. Synthetic peptide located within the following region: MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: mortality factor 4 like 2
• Database Link:
  NP_036418
  Entrez Gene 9643 Human
  UniProt ID Q15014
• Background: MORF4L2 is a member of the mortality factor (MORF) family of putative transcriptional regulators
• Synonyms: MORFL2; MRGX
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Rabbit: 92%; Yeast: 91%; Bovine: 85%; Guinea pig: 85%

Reference Data

• Protein Families: Transcription Factors