Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-MORF4L2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MORF4L2 antibody: synthetic peptide directed towards the N terminal of human MORF4L2. Synthetic peptide located within the following region: PPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFK |
Rabbit Polyclonal Anti-MORF4L2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MORF4L2 antibody: synthetic peptide directed towards the N terminal of human MORF4L2. Synthetic peptide located within the following region: MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKN |
Goat Polyclonal Antibody against MRGX
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence SSRKQGSQPRGQQS-C, from the N Terminus of the protein sequence according to NP_036418.1. |
MORF4L2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MORF4L2 |
MORF4L2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MORF4L2 (NP_001135890.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- MORF4L2