Mortality Factor 4 like 2 (MORF4L2) Rabbit Polyclonal Antibody

CAT#: TA334236

Rabbit Polyclonal Anti-MORF4L2 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "MORF4L2"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MORF4L2 antibody: synthetic peptide directed towards the N terminal of human MORF4L2. Synthetic peptide located within the following region: PPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 32 kDa
Gene Name mortality factor 4 like 2
Background MORF4L2 is a member of the mortality factor (MORF) family of putative transcriptional regulators
Synonyms MORFL2; MRGX
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 93%; Guinea pig: 93%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.