PTGR1 Rabbit Polyclonal Antibody

CAT#: TA334445

Rabbit Polyclonal Anti-PTGR1 Antibody

Product Images

WB Suggested Anti-PTGR1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PTGR1 antibody: synthetic peptide directed towards the N terminal of human PTGR1. Synthetic peptide located within the following region: VRTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: prostaglandin reductase 1
• Database Link:
  NP_036344
  Entrez Gene 22949 Human
  UniProt ID Q14914
• Background: PTGR1 functions as 15-oxo-prostaglandin 13-reductase and acts on 15-oxo-PGE1, 15-oxo-PGE2 and 15-oxo-PGE2-alpha. It has no activity towards PGE1, PGE2 and PGE2-alpha. PTGR1 catalyzes the conversion of leukotriene B4 into its biologically less active metabolite, 12-oxo-leukotriene B4. This is an initial and key step of metabolic inactivation of leukotriene B4.
• Synonyms: LTB4DH; PGR1; ZADH3
• Note: Immunogen Sequence Homology: Human: 93%; Bovine: 93%; Pig: 83%; Horse: 83%; Rabbit: 83%; Guinea pig: 83%; Rat: 79%

Reference Data

• Protein Families: Druggable Genome