MICA Rabbit Polyclonal Antibody

CAT#: TA334662

Rabbit Polyclonal Anti-MICA Antibody

Product Images

Host: Rabbit; Target Name: MICA; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MICA antibody is: synthetic peptide directed towards the middle region of Human MICA. Synthetic peptide located within the following region: VQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: MHC class I polypeptide-related sequence A
• Database Link:
  NP_001170990
  Entrez Gene 100507436 Human
  UniProt ID Q29983
• Background: MICA encodes the higly polymorphic MHC (HLA) class I chain-related gene A. The protein product is expressed on the cell surface, although unlike canonical class I molecules does not seem to associate with beta-2-microglobulin. It is thought that MICA functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. Alternative splicing results in multiple transcript variants.
• Synonyms: MIC-A; PERB11.1
• Note: Immunogen Sequence Homology: Human: 100%