Kallikrein 6 (KLK6) Rabbit Polyclonal Antibody

CAT#: TA334684

Rabbit Polyclonal Anti-KLK6 Antibody

Product Images

WB Suggested Anti-KLK6 Antibody Titration: 0.2-1 ug/ml; Positive Control: 721_B cell lysate

• 

  Host: Rabbit; Target Name: KLK6; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

• 

  Lung

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KLK6 antibody: synthetic peptide directed towards the N terminal of human KLK6. Synthetic peptide located within the following region: KHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: kallikrein related peptidase 6
• Database Link:
  NP_001012982
  Entrez Gene 5653 Human
  UniProt ID Q92876
• Background: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. The gene that encodes KLK6 protein is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. KLK6 is regulated by steroid hormones. In tissue culture, the enzyme has been found to generate amyloidogenic fragments from the amyloid precursor protein, suggesting a potential for involvement in Alzheimer's disease.Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. The encoded enzyme is regulated by steroid hormones. In tissue culture, the enzyme has been found to generate amyloidogenic fragments from the amyloid precursor protein, suggesting a potential for involvement in Alzheimer's disease. Multiple alternatively spliced transcript variants that encode different isoforms have been identified for this gene.
• Synonyms: Bssp; hK6; Klk7; PRSS9; PRSS18; SP59
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 92%; Horse: 92%

Reference Data

• Protein Families: Druggable Genome, Protease, Secreted Protein