KIF22 Rabbit Polyclonal Antibody

CAT#: TA334696

Rabbit Polyclonal Anti-KIF22 Antibody

Product Images

WB Suggested Anti-KIF22 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Transfected 293T

• 

  Lanes: 1. Xenopus laevis egg extract 0.3 ul/lane; Primary Antibody Dilution: ; 1:1000; Secondary Antibody: ; Anti-Rabbit HRP; Secondary Antibody Dilution: ; 1:5000; Gene Name: ; KIF22; Submitted by: ; Anonymous;

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Xenopus
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KIF22 antibody: synthetic peptide directed towards the N terminal of human KIF22. Synthetic peptide located within the following region: CSLEIANWRNHQETLKYQFDAFYGERSTQQDIYAGSVQPILRHLLEGQNA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 73 kDa
• Gene Name: kinesin family member 22
• Database Link:
  NP_015556
  Entrez Gene 3835 Human
  UniProt ID Q14807
• Background: KIF22 a member of kinesin-like protein family. This family of proteins are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. The C-terminal half of this protein has been shown to bind DNA. Studies with the Xenopus homolog suggests its essential role in metaphase chromosome alignment and maintenance. The protein encoded by this gene is a member of kinesin-like protein family. This family of proteins are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. The C-terminal half of this protein has been shown to bind DNA. Studies with the Xenopus homolog suggests its essential role in metaphase chromosome alignment and maintenance. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: A-328A3.2; KID; KNSL4; OBP; OBP-1; OBP-2; SEMDJL2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Mouse: 93%; Yeast: 89%

Reference Data

• Protein Families: Druggable Genome