RNF13 Rabbit Polyclonal Antibody

CAT#: TA334769

Rabbit Polyclonal Anti-RNF13 Antibody

Product Images

Host: Rabbit; Target Name: RNF13; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

• 

  WB Suggested Anti-RNF13 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Hela cell lysateRNF13 is supported by BioGPS gene expression data to be expressed in HeLa

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RNF13 antibody: synthetic peptide directed towards the N terminal of human RNF13. Synthetic peptide located within the following region: ILAYNFENASQTFDDLPARFGYRLPAEGLKGFLINSKPENACEPIVPPPV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: ring finger protein 13
• Database Link:
  NP_009213
  Entrez Gene 11342 Human
  UniProt ID O43567
• Background: RNF13 contains 1 RING-type zinc finger. The exact function of RNF13 is not known.The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. The specific function of this gene has not yet been determined. Alternatively spliced transcript variants that encode the same protein have been reported. A pseudogene, which is also located on chromosome 3, has been defined for this gene.
• Synonyms: RZF
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Protease, Transmembrane