Recoverin (RCVRN) Rabbit Polyclonal Antibody

CAT#: TA334775

Rabbit Polyclonal Anti-RCVRN Antibody

Product Images

WB Suggested Anti-RCVRN Antibody; Titration: 1.0 ug/ml; Positive Control: Jurkat Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RCVRN antibody: synthetic peptide directed towards the C terminal of human RCVRN. Synthetic peptide located within the following region: DVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: recoverin
• Database Link:
  NP_002894
  Entrez Gene 5957 Human
  UniProt ID P35243
• Background: RCVRN is a member of the recoverin family of neuronal calcium sensors. The protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy.
• Synonyms: RCV1
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Rabbit: 86%; Guinea pig: 86%