C19orf75 (SIGLECL1) Rabbit Polyclonal Antibody

CAT#: TA334849

Rabbit Polyclonal Anti-SIGLECL1 Antibody

Product Images

Host: Rabbit; Target Name: SIGLECL1; Sample Tissue: Fetal Kidney lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SIGLECL1 antibody is: synthetic peptide directed towards the C-terminal region of Human SIGLECL1. Synthetic peptide located within the following region: RKKQAKKAAAIRAKKSSKVRASQELEMSLKPEEPGKPVVATFSESRILEK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: SIGLEC family like 1
• Database Link:
  NP_775906
  Entrez Gene 284369 Human
  UniProt ID Q8N7X8
• Background: The function of this protein remains unknown.
• Synonyms: C19orf75; SIGLEC23P; SIGLECP7
• Note: Immunogen Sequence Homology: Human: 100%; Yeast: 83%

Reference Data

• Protein Families: Transmembrane