GNAL Rabbit Polyclonal Antibody

CAT#: TA335039

Rabbit Polyclonal Anti-GNAL Antibody

Product Images

WB Suggested Anti-GNAL Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Hela cell lysateGNAL is supported by BioGPS gene expression data to be expressed in HeLa

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GNAL antibody: synthetic peptide directed towards the C terminal of human GNAL. Synthetic peptide located within the following region: AEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: G protein subunit alpha L
• Database Link:
  NP_892023
  Entrez Gene 2774 Human
  UniProt ID P38405
• Background: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. G(olf) alpha mediates signal transduction within the olfactory neuroepithelium and the basal ganglia. It may be involved in some aspect of visual transduction, and in mediating the effect of one or more hormones/neurotransmitters.
• Synonyms: DYT25
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Calcium signaling pathway, Olfactory transduction