Monoamine Oxidase A (MAOA) Rabbit Polyclonal Antibody

CAT#: TA335132

Rabbit polyclonal Anti-MAOA Antibody

Product Images

WB Suggested Anti-MAOA Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MAOA antibody: synthetic peptide directed towards the N terminal of human MAOA. Synthetic peptide located within the following region: GPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: monoamine oxidase A
• Database Link:
  NP_000231
  Entrez Gene 4128 Human
  UniProt ID P21397
• Background: MAOA catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine.This gene encodes monoamine oxidase A, an enzyme that degrades amine neurotransmitters, such as dopamine, norepinephrine, and serotonin. The protein localizes to the mitochondrial outer membrane. The gene is adjacent to a related gene on the opposite strand of chromosome X. Mutation in this gene results in monoamine oxidase deficiency, or Brunner syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: BRNRS; MAO-A
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Zebrafish: 77%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Arginine and proline metabolism, Drug metabolism - cytochrome P450, Glycine, serine and threonine metabolism, Histidine metabolism, Metabolic pathways, Phenylalanine metabolism, Tryptophan metabolism, Tyrosine metabolism