VAX1 Rabbit Polyclonal Antibody

CAT#: TA335335

Rabbit Polyclonal Anti-Vax1 Antibody

Product Images

WB Suggested Anti-Vax1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Vax1 Antibody: synthetic peptide directed towards the N terminal of human Vax1. Synthetic peptide located within the following region: MFGKPDKMDVRCHSDAEAARVSKNAHKESRESKGAEGNLPAAFLKEPQGA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: ventral anterior homeobox 1
• Database Link:
  NP_954582
  Entrez Gene 11023 Human
  UniProt ID Q5SQQ9
• Background: VAX1 is a homeo-domain containing protein from a class of homeobox transcription factors which are conserved in vertebrates. It may play an important role in the development of anterior ventral forebrain and visual system.This gene encodes a homeo-domain containing protein from a class of homeobox transcription factors which are conserved in vertebrates. Genes of this family are involved in the regulation of body development and morphogenesis. The most conserved genes, called HOX genes are found in special gene clusters. This gene belongs to the VAX subfamily and lies in the vicinity of the EMX homeobox gene family. Another member of VAX family is located on chromosome 2. The encoded protein may play an important role in the development of anterior ventral forebrain and visual system. Multiple transcript variants encoding different isoforms have been found for this gene. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-180 AK127095.1 1-180 181-201 AL731557.7 35785-35805 c 202-1186 AK127095.1 199-1183 1187-4494 AL731557.7 26205-29512 c
• Synonyms: MCOPS11
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%

Reference Data

• Protein Families: Transcription Factors