VAX1 Rabbit Polyclonal Antibody

CAT#: TA335336

Rabbit Polyclonal Anti-VAX1 Antibody

Product Images

Host: Rabbit; Target Name: VAX1; Sample Tissue: Ovary Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-VAX1 Antibody is: synthetic peptide directed towards the N-terminal region of Human VAX1. Synthetic peptide located within the following region: HKESRESKGAEGNLPAAFLKEPQGAFSASGAAEDCNKSKSNSAADPDYCR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: ventral anterior homeobox 1
• Database Link:
  NP_954582
  Entrez Gene 11023 Human
  UniProt ID Q5SQQ9
• Background: VAX1 is a homeo-domain containing protein from a class of homeobox transcription factors which are conserved in vertebrates. It may play an important role in the development of anterior ventral forebrain and visual system.
• Synonyms: MCOPS11
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Rat: 92%; Mouse: 92%

Reference Data

• Protein Families: Transcription Factors