VAX1 Rabbit Polyclonal Antibody

CAT#: TA335336

Rabbit Polyclonal Anti-VAX1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "VAX1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-VAX1 Antibody is: synthetic peptide directed towards the N-terminal region of Human VAX1. Synthetic peptide located within the following region: HKESRESKGAEGNLPAAFLKEPQGAFSASGAAEDCNKSKSNSAADPDYCR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 36 kDa
Gene Name ventral anterior homeobox 1
Background VAX1 is a homeo-domain containing protein from a class of homeobox transcription factors which are conserved in vertebrates. It may play an important role in the development of anterior ventral forebrain and visual system.
Synonyms MCOPS11
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Rat: 92%; Mouse: 92%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.