CNTD2 Rabbit Polyclonal Antibody

CAT#: TA335458

Rabbit Polyclonal Anti-CNTD2 Antibody

Product Images

Host: Rabbit; Target Name: CNTD2; Sample Tissue: HepG2 Whole cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CNTD2 Antibody is: synthetic peptide directed towards the N-terminal region of Human CNTD2. Synthetic peptide located within the following region: PDGFPAGPTVSPRRLARPPGLEEALSALGLQGEREYAGDIFAEVMEYLGL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 17 kDa
• Gene Name: cyclin N-terminal domain containing 2
• Database Link:
  NP_079153
  Entrez Gene 79935 Human
  UniProt ID Q9H8S5
• Background: The function of this protein remains unknown.
• Synonyms: CCNP
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Rabbit: 86%; Bovine: 83%