TFB1M Rabbit Polyclonal Antibody

CAT#: TA335574

Rabbit Polyclonal Anti-TFB1M Antibody

Product Images

WB Suggested Anti-TFB1M Antibody Titration: 2.5 ug/ml; ELISA Titer: 1:312500; Positive Control: 721_B cell lysateTFB1M is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TFB1M Antibody: synthetic peptide directed towards the middle region of human TFB1M. Synthetic peptide located within the following region: IIKWLENISCRDGPFVYGRTQMTLTFQKEVAERLAANTGSKQRSRLSVMA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: transcription factor B1, mitochondrial
• Database Link:
  NP_057104
  Entrez Gene 51106 Human
  UniProt ID Q8WVM0
• Background: The transcription of genes from mitochondrial DNA requires a mitochondrial RNA polymerase and a DNA-binding transcription factor. Transcription factor B1 (TFB1M) is a part of this transcription complex.The transcription of genes from mitochondrial DNA requires a mitochondrial RNA polymerase (see POLRMT, MIM 601778) and a DNA-binding transcription factor (see TFAM, MIM 600438). Transcription factor B1 (TFB1M) is a part of this transcription complex. [supplied by OMIM]
• Synonyms: CGI-75; CGI75; mtTFB; mtTFB1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rabbit: 93%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Guinea pig: 86%; Zebrafish: 79%

Reference Data

• Protein Families: Transcription Factors