Goat Anti-TFB1M Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-ELKRRKSKNEEKE, from the C-Terminus of the protein sequence according to NP_057104.2. |
Goat Anti-TFB1M Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-ELKRRKSKNEEKE, from the C-Terminus of the protein sequence according to NP_057104.2. |
Rabbit Polyclonal Anti-TFB1M Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TFB1M Antibody: synthetic peptide directed towards the N terminal of human TFB1M. Synthetic peptide located within the following region: NFLLDLRLTDKIVRKAGNLTNAYVYEVGPGPGGITRSILNADVAELLVVE |
Rabbit Polyclonal Anti-TFB1M Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TFB1M Antibody: synthetic peptide directed towards the middle region of human TFB1M. Synthetic peptide located within the following region: IIKWLENISCRDGPFVYGRTQMTLTFQKEVAERLAANTGSKQRSRLSVMA |
Carrier-free (BSA/glycerol-free) TFB1M mouse monoclonal antibody, clone OTI6G4 (formerly 6G4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TFB1M mouse monoclonal antibody, clone OTI11H1 (formerly 11H1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) TFB1M mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TFB1M mouse monoclonal antibody, clone OTI13H2 (formerly 13H2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TFB1M mouse monoclonal antibody, clone OTI10H8 (formerly 10H8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TFB1M Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 28-346 of human TFB1M (NP_057104.2). |
Modifications | Unmodified |
TFB1M mouse monoclonal antibody, clone OTI6G4 (formerly 6G4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TFB1M mouse monoclonal antibody, clone OTI6G4 (formerly 6G4), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
TFB1M mouse monoclonal antibody, clone OTI6G4 (formerly 6G4), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
TFB1M mouse monoclonal antibody, clone OTI6G4 (formerly 6G4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TFB1M mouse monoclonal antibody, clone OTI11H1 (formerly 11H1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TFB1M mouse monoclonal antibody, clone OTI11H1 (formerly 11H1), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
TFB1M mouse monoclonal antibody, clone OTI11H1 (formerly 11H1), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
TFB1M mouse monoclonal antibody, clone OTI11H1 (formerly 11H1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TFB1M mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TFB1M mouse monoclonal antibody, clone OTI3G8 (formerly 3G8), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
TFB1M mouse monoclonal antibody, clone OTI3G8 (formerly 3G8), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
TFB1M mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TFB1M mouse monoclonal antibody, clone OTI13H2 (formerly 13H2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TFB1M mouse monoclonal antibody, clone OTI13H2 (formerly 13H2), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
TFB1M mouse monoclonal antibody, clone OTI13H2 (formerly 13H2), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
TFB1M mouse monoclonal antibody, clone OTI13H2 (formerly 13H2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Purified TFB1M mouse monoclonal antibody, clone OTI10H8 (formerly 10H8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Purified TFB1M mouse monoclonal antibody, clone OTI10H8 (formerly 10H8), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Purified TFB1M mouse monoclonal antibody, clone OTI10H8 (formerly 10H8), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Purified TFB1M mouse monoclonal antibody, clone OTI10H8 (formerly 10H8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |