MRF (MYRF) Rabbit Polyclonal Antibody

CAT#: TA335643

Rabbit Polyclonal Anti-MYRF Antibody

Product Images

WB Suggested Anti-C11orf9 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-C11orf9 Antibody: synthetic peptide directed towards the N terminal of human C11orf9. Synthetic peptide located within the following region: GTGPPIKAEPKAPYAPGTLPDSPPDSGSEAYSPQQVNEPHLLRTITPETL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 120 kDa
• Gene Name: myelin regulatory factor
• Database Link:
  NP_037411
  Entrez Gene 745 Human
  UniProt ID Q9Y2G1
• Background: C11orf9 is a single-pass membrane protein.
• Synonyms: C11orf9; MRF; Ndt80; pqn-47
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%