USF1 Rabbit Polyclonal Antibody

CAT#: TA335666

Rabbit Polyclonal Anti-USF1 Antibody

Product Images

WB Suggested Anti-USF1 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysateWHSC1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-USF1 Antibody: synthetic peptide directed towards the N terminal of human USF1. Synthetic peptide located within the following region: DPTSVAIASIQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQLDGQTE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: upstream transcription factor 1
• Database Link:
  NP_009053
  Entrez Gene 7391 Human
  UniProt ID P22415
• Background: USF1 encodes a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs. This gene has been linked to familial combined hyperlipidemia (FCHL).
• Synonyms: bHLHb11; FCHL; FCHL1; HYPLIP1; MLTF; MLTFI; UEF
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors