TCP1 delta (CCT4) Rabbit Polyclonal Antibody

CAT#: TA335688

Rabbit Polyclonal Anti-CCT4 Antibody

Product Images

WB Suggested Anti-CCT4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate; CCT4 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  CCT4 antibody - C-terminal region validated by WB using 293T cells lysate; CCT4 is supported by BioGPS gene expression data to be expressed in HEK293T

• 

  CCT4 antibody - C-terminal region validated by WB using HEK 293T cells at 1:1,000 dilution for antibody samples and 1:10,000 for secondary antibodies.CCT4 is supported by BioGPS gene expression data to be expressed in HEK293T

• 

  Sample: HEK 293 cells; Dilution: 1 to 1000.CCT4 is supported by BioGPS gene expression data to be expressed in HEK293

• 

  Sample Type. Rat Hippocampal Neurons - 14DIVPrimary Antibody Dilution. 1:200 Secondary Antibody. Anti-rabbit-Cy3Secondary Antibody Dilution. 1:500Color/Signal Descriptions. White: CCT4Gene Name. CCT4Submitted by. Dan Fowler - University of Oregon, Institute of Neuroscience

• 

  Rabbit Anti-CCT4 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue; Observed Staining: Cytoplasmic; Primary Antibody Concentration: 1:100; Secondary Antibody: Donkey anti-Rabbit-Cy3; Secondary Antibody Concentration: 1:200; Magnification: 20X; Exposure Time: 0.5 - 2.0 sec;

Show all 6 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CCT4 Antibody: synthetic peptide directed towards the C terminal of human CCT4. Synthetic peptide located within the following region: AFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: chaperonin containing TCP1 subunit 4
• Database Link:
  NP_006421
  Entrez Gene 29374 RatEntrez Gene 10575 Human
  UniProt ID P50991
• Background: The CCT (chaperonin containing TCP-1) complex functions as a molecular chaperone in the eukaryotic cytosol. CCT4 interacts with human cyclin E which has been implicated in positive control of the G1/S phase transition.
• Synonyms: CCT-DELTA; Cctd; SRB
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Yeast: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%; Guinea pig: 93%; Goat: 79%

Reference Data

• Protein Families: Druggable Genome