Antibodies

View as table Download

Rabbit Polyclonal Anti-CCT4 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-CCT4 Antibody: synthetic peptide directed towards the C terminal of human CCT4. Synthetic peptide located within the following region: AFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISN

Rabbit Polyclonal Anti-CCT4 Antibody

Applications IHC, WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-CCT4 Antibody: synthetic peptide directed towards the C terminal of human CCT4. Synthetic peptide located within the following region: AFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISN

TCP1 delta (CCT4) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 3-32 amino acids from the N-terminal region of human CCT4

Carrier-free (BSA/glycerol-free) CCT4 mouse monoclonal antibody,clone OTI4E6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CCT4 mouse monoclonal antibody,clone OTI5E5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CCT4 mouse monoclonal antibody,clone OTI3C12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CCT4 mouse monoclonal antibody,clone OTI4C9

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CCT4 mouse monoclonal antibody,clone OTI1A3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CCT4 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 130-390 of human CCT4 (NP_006421.2).
Modifications Unmodified