TCP1 delta (CCT4) Rabbit Polyclonal Antibody

CAT#: TA335689

Rabbit Polyclonal Anti-CCT4 Antibody

Product Images

WB Suggested Anti-CCT4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500 Positive Control: HepG2 cell lysate; CCT4 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  CCT4 antibody - C-terminal region validated by WB using 293T cells lysate; CCT4 is supported by BioGPS gene expression data to be expressed in HEK293T

• 

  Lanes: Lane 1: Negative control (anti-FLAG antibody); Lane 2: Immunoprecipitation with CCT4 (C-term); Lane 3: 10 ug lysate; Primary Antibody Dilution: ; 1:1000; Secondary Antibody: ; Goat anti-rabbit; Secondary Antibody Dilution: ; 1:10000; Gene Name: ; CCT4; Submitted by: ; Amy Gray, Department of Chemistry and Biochemistry Brigham Young University; CCT4 is supported by BioGPS gene expression data to be expressed in HEK293T

• 

  Sample Type : Rat Hippocampal Neurons - 14DIV Primary Antibody Dilution : 1:200 Secondary Antibody : Anti-rabbit-Cy3 Secondary Antibody Dilution : 1:500 Color/Signal Descriptions : White: CCT4 Gene Name : CCT4 Submitted by : Dan Fowler - University of Oregon, Institute of Neuroscience

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CCT4 Antibody: synthetic peptide directed towards the C terminal of human CCT4. Synthetic peptide located within the following region: AFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: chaperonin containing TCP1 subunit 4
• Database Link:
  NP_006421
  Entrez Gene 29374 Rat
  UniProt ID P50991
• Background: CCT4 is a subunit of a cytosolic hetero-oligomeric chaperone that is known to be involved in the folding of actin and tubulin. This protein is a member of the chaperonin family, which includes Escherichia coli GroEL, the mitochondrial heat-shock protein Hsp60, the plastid Rubisco-subunit-binding protein and the archaebacterial protein TF55.
• Synonyms: CCT-DELTA; Cctd; SRB
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Yeast: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%; Guinea pig: 93%; Goat: 79%

Reference Data

• Protein Families: Druggable Genome