Chromosome X open reading frame 6 (MAMLD1) Rabbit Polyclonal Antibody

CAT#: TA335711

Rabbit Polyclonal Anti-MAMLD1 Antibody

Product Images

WB Suggested Anti-CXORF6 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:1562500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CXORF6 Antibody: synthetic peptide directed towards the N terminal of human CXORF6. Synthetic peptide located within the following region: LEELTKIQDPSPNELDLEKILGTKPEEPLVLDHPQATLSTTPKPSVQMSH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 74 kDa
• Gene Name: mastermind like domain containing 1
• Database Link:
  NP_005482
  Entrez Gene 10046 Human
  UniProt ID Q13495
• Background: CXorf6 is a protein predicted based on an ORF found in chromosome 14
• Synonyms: CG1; CXorf6; F18; HYSP2
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Horse: 86%; Rabbit: 86%; Rat: 79%; Mouse: 79%; Guinea pig: 79%