BMI1 Rabbit Polyclonal Antibody

CAT#: TA335718

Rabbit Polyclonal Anti-BMI1 Antibody

Product Images

WB Suggested Anti-PCGF4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: A172 cell lysate; BMI1 is supported by BioGPS gene expression data to be expressed in A172

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PCGF4 Antibody: synthetic peptide directed towards the C terminal of human PCGF4. Synthetic peptide located within the following region: TPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: BMI1 proto-oncogene, polycomb ring finger
• Database Link:
  NP_005171
  Entrez Gene 648 Human
• Background: PCGF4 regulates telomerase expression in MECs and plays a role in the development of human breast cancer.
• Synonyms: BMI1; FLVI2; PCGF4; RNF51
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 86%; Yeast: 83%

Reference Data

• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors