HMGA1 Rabbit Polyclonal Antibody

CAT#: TA335852

Rabbit Polyclonal Anti-HMGA1 Antibody

Product Images

WB Suggested Anti-HMGA1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HT1080 cell lysate. HMGA1 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-HMGA1 Antibody: synthetic peptide directed towards the N terminal of human HMGA1. Synthetic peptide located within the following region: MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 11 kDa
• Gene Name: high mobility group AT-hook 1
• Database Link:
  NP_002122
  Entrez Gene 3159 Human
  UniProt ID P17096
• Background: This gene encodes a non-histone protein involved in many cellular processes, including regulation of inducible gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of A+T-rich regions in double-stranded DNA. It has little secondary structure in solution but assumes distinct conformations when bound to substrates such as DNA or other proteins. The encoded protein is frequently acetylated and is found in the nucleus. At least seven transcript variants encoding two different isoforms have been found for this gene.
• Synonyms: HMG-R; HMGA1A; HMGIY
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome, Stem cell - Pluripotency, Stem cell relevant signaling - JAK/STAT signaling pathway, Transcription Factors