EIF5A Rabbit Polyclonal Antibody

CAT#: TA335857

Rabbit Polyclonal Anti-EIF5A Antibody

Product Images

Host: Rabbit; Target Name: EIF5A; Sample Tissue: NCI-H226 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that EIF5A is expressed in NCIH226

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-EIF5A Antibody is: synthetic peptide directed towards the N-terminal region of Human EIF5A. Synthetic peptide located within the following region: LKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: eukaryotic translation initiation factor 5A
• Database Link:
  NP_001961
  Entrez Gene 1984 Human
  UniProt ID P63241
• Background: EIF5A is a mRNA-binding protein involved in translation elongation. It has an important function at the level of mRNA turnover, probably acting downstream of decapping. It is involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. With syntenin SDCBP, EIF5A functions as a regulator of p53/TP53 and p53/TP53-dependent apoptosis. EIF5A regulates also TNF-alpha-mediated apoptosis and mediates effects of polyamines on neuronal process extension and survival. It may play an important role in brain development and function, and in skeletal muscle stem cell differentiation. EIF5A is also described as a cellular cofactor of human T-cell leukemia virus type I (HTLV-1) Rex protein and of human immunodeficiency virus type 1 (HIV-1) Rev protein, essential for mRNA export of retroviral transcripts.
• Synonyms: EIF-5A; EIF5A1; eIF5AI
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%