FAIM1 (FAIM) Rabbit Polyclonal Antibody

CAT#: TA336028

Rabbit Polyclonal Anti-FAIM Antibody

Product Images

WB Suggested Anti-FAIM Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: OVCAR-3 cell lysate. FAIM is supported by BioGPS gene expression data to be expressed in OVCAR3

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FAIM Antibody: synthetic peptide directed towards the middle region of human FAIM. Synthetic peptide located within the following region: FRIVLEKDAMDVWCNGKKLETAGEFVDDGTETHFSIGNHDCYIKAVSSGK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: Fas apoptotic inhibitory molecule
• Database Link:
  NP_001028202
  Entrez Gene 55179 Human
  UniProt ID Q9NVQ4
• Background: FAIM plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells.
• Synonyms: FAIM1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Zebrafish: 93%