Germany
Japan
United Kingdom
China
Antibodies
View as table Download
FAIM1 (FAIM) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 64-93 amino acids from the Central region of human FAIM. |
Goat Polyclonal Antibody against FAIM
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KKYMEDRSKTTN, from the internal region of the protein sequence according to NP_001028202.1; NP_001028203.1; NP_001028204.1; NP_060617.1. |
Rabbit Polyclonal FAIM Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | FAIM antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human FAIM . |
Anti-FAIM Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-FAIM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FAIM Antibody: synthetic peptide directed towards the N terminal of human FAIM. Synthetic peptide located within the following region: MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVG |
Rabbit Polyclonal Anti-FAIM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FAIM Antibody: synthetic peptide directed towards the middle region of human FAIM. Synthetic peptide located within the following region: FRIVLEKDAMDVWCNGKKLETAGEFVDDGTETHFSIGNHDCYIKAVSSGK |
Rabbit Polyclonal Anti-FAIM Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human FAIM |
FAIM Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FAIM |
FAIM Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FAIM |
Active filters
Target Symbol
- FAIM