MPG Rabbit Polyclonal Antibody

CAT#: TA336087

Rabbit Polyclonal Anti-MPG Antibody

Product Images

WB Suggested Anti-MPG Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

• 

  WB Suggested Anti-MPG Antibody; Positive Control: Lane 1: 50ug RCC4 lysate, Lane 2: 50ug RCC4 lysate, Lane 3: 50ug 786-0 lysate, Lane 4: 50ug 786-0 lysate; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Anti-rabbit-Alexa 680; Secondry Antibody Dilution: 1: 5000; Submitted by: Dr Ester Hammond, Gray Institute for Radiation Oncology and Biology-Department of Oncology, University of Oxford

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MPG Antibody: synthetic peptide directed towards the C terminal of human MPG. Synthetic peptide located within the following region: LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: N-methylpurine DNA glycosylase
• Database Link:
  NP_001015052
  Entrez Gene 4350 Human
  UniProt ID P29372
• Background: MPG functions in the hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine, and 7-methylguanine from the damaged DNA polymer formed by alkylation lesions.
• Synonyms: AAG; ADPG; anpg; APNG; CRA36.1; MDG; Mid1; PIG11; PIG16
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 85%; Rabbit: 85%; Dog: 79%; Pig: 79%; Horse: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Base excision repair