PSIP1 Rabbit Polyclonal Antibody

CAT#: TA337269

Rabbit Polyclonal Anti-PSIP1 Antibody

Product Images

Human Jurkat

• 

  WB Suggested Anti-PSIP1 Antibody; Titration: 5 ug/ml; Positive Control: Jurkat Whole Cell PSIP1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

• 

  Rabbit Anti-PSIP1 antibody; Paraffin Embedded Tissue: Human Lung cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PSIP1 antibody: synthetic peptide directed towards the middle region of human PSIP1. Synthetic peptide located within the following region: AADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: PC4 and SFRS1 interacting protein 1
• Database Link:
  NP_150091
  Entrez Gene 11168 Human
  UniProt ID O75475
• Background: PSIP1 is a transcriptional coactivator. It also acts as an adaptor to coordinate pre-mRNA splicing and transcriptional activation of class II genes.
• Synonyms: DFS70; LEDGF; p52; p75; PAIP; PSIP2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Stem cell - Pluripotency, Transcription Factors