FAM36A (COX20) Rabbit Polyclonal Antibody

CAT#: TA337607

Rabbit Polyclonal Anti-COX20 Antibody

Product Images

WB Suggested Anti-COX20 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-COX20 antibody: synthetic peptide directed towards the C terminal of human COX20. Synthetic peptide located within the following region: LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 13 kDa
• Gene Name: COX20 cytochrome c oxidase assembly factor
• Database Link:
  NP_932342
  Entrez Gene 116228 Human
  UniProt ID Q5RI15
• Background: COX20 is a multi-pass membrane protein. It belongs to the FAM36 family. The exact function of COX20 remains unknown.
• Synonyms: FAM36A
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 90%; Mouse: 90%; Horse: 79%; Rabbit: 79%