FAM36A (COX20) Rabbit Polyclonal Antibody

CAT#: TA337607

Rabbit Polyclonal Anti-COX20 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "COX20"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-COX20 antibody: synthetic peptide directed towards the C terminal of human COX20. Synthetic peptide located within the following region: LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 13 kDa
Gene Name COX20 cytochrome c oxidase assembly factor
Background COX20 is a multi-pass membrane protein. It belongs to the FAM36 family. The exact function of COX20 remains unknown.
Synonyms FAM36A
Note Immunogen Sequence Homology: Human: 100%; Rat: 90%; Mouse: 90%; Horse: 79%; Rabbit: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.