NPTX2 Rabbit Polyclonal Antibody

CAT#: TA337669

Rabbit Polyclonal Anti-NPTX2 Antibody

Product Images

WB Suggested Anti-NPTX2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NPTX2 antibody: synthetic peptide directed towards the N terminal of human NPTX2. Synthetic peptide located within the following region: VQQKETLGAQREAIRELTGKLARCEGLAGGKARGAGATGKDTMGDLPRDP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: neuronal pentraxin 2
• Database Link:
  NP_002514
  Entrez Gene 4885 Human
  UniProt ID P47972
• Background: This gene encodes a member of the family of neuronal petraxins, synaptic proteins that are related to C-reactive protein. This protein is involved in excitatory synapse formation. It also plays a role in clustering of alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA)-type glutamate receptors at established synapses, resulting in non-apoptotic cell death of dopaminergic nerve cells. Up-regulation of this gene in Parkinson disease (PD) tissues suggests that the protein may be involved in the pathology of PD.
• Synonyms: NARP; NP-II; NP2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%

Reference Data

• Protein Families: Secreted Protein