KEAP1 Rabbit Polyclonal Antibody

CAT#: TA337702

Rabbit Polyclonal Anti-KEAP1 Antibody

Product Images

WB Suggested Anti-KEAP1 Antibody Titration: 1.0 ug/ml; Positive Control: HepG2 cell lysate KEAP1 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Host: Rabbit; Target Name: KEAP1; Sample Tissue: HepG2; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide ; Primary Antibody Concentration:1.25ug/mL; Peptide Concentration: 1.0ug/mL; Lysate Quantity: 25ug/lane; Gel Concentration: 12%KEAP

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KEAP1 antibody: synthetic peptide directed towards the C terminal of human KEAP1. Synthetic peptide located within the following region: TWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 70 kDa
• Gene Name: kelch like ECH associated protein 1
• Database Link:
  NP_987096
  Entrez Gene 9817 Human
  UniProt ID Q14145
• Background: KEAP1 contains KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase.This gene encodes a protein containing KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase. Two alternatively spliced transcript variants encoding the same isoform have been found for this gene.
• Synonyms: INrf2; KLHL19
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Ubiquitin mediated proteolysis