Munc 13 4 (UNC13D) Rabbit Polyclonal Antibody

CAT#: TA337705

Rabbit Polyclonal Anti-UNC13D Antibody

Product Images

Host: Rabbit; Target Name: UNC13D; Sample Tissue: Fetal Lung lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UNC13D antibody is: synthetic peptide directed towards the C-terminal region of Human UNC13D. Synthetic peptide located within the following region: SGSEEPGEVPQTRLPLTYPAPNGDPILQLLEGRKGDREAQVFVRLRRHRA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 119 kDa
• Gene Name: unc-13 homolog D
• Database Link:
  NP_954712
  Entrez Gene 201294 Human
  UniProt ID Q70J99
• Background: This gene encodes a protein that is a member of the UNC13 family, containing similar domain structure as other family members but lacking an N-terminal phorbol ester-binding C1 domain present in other Munc13 proteins. The protein appears to play a role in vesicle maturation during exocytosis and is involved in regulation of cytolytic granules secretion. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis type 3, a genetically heterogeneous, rare autosomal recessive disorder.
• Synonyms: FHL3; HLH3; HPLH3; Munc13-4
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Horse: 93%; Pig: 92%; Mouse: 92%; Bovine: 92%; Guinea pig: 92%; Rabbit: 86%