Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Anti-Munc13-4 / UNC13D (C terminus) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KQASQHALRPAP, from the C Terminus of the protein sequence according to NP_954712.1. |
Rabbit Polyclonal Anti-UNC13D Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UNC13D antibody is: synthetic peptide directed towards the C-terminal region of Human UNC13D. Synthetic peptide located within the following region: SGSEEPGEVPQTRLPLTYPAPNGDPILQLLEGRKGDREAQVFVRLRRHRA |
Carrier-free (glycerol/BSA-free) UNC13D mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
UNC13D Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 891-1090 of human UNC13D (NP_954712.1). |
| Modifications | Unmodified |
UNC13D mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
UNC13D mouse monoclonal antibody, clone OTI1F4 (formerly 1F4), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
UNC13D mouse monoclonal antibody, clone OTI1F4 (formerly 1F4), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
UNC13D mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- UNC13D