FUNDC1 Rabbit Polyclonal Antibody

CAT#: TA337771

Rabbit Polyclonal Anti-FUNDC1 Antibody

Product Images

WB Suggested Anti-FUNDC1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FUNDC1 antibody: synthetic peptide directed towards the N terminal of human FUNDC1. Synthetic peptide located within the following region: MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 17 kDa
• Gene Name: FUN14 domain containing 1
• Database Link:
  NP_776155
  Entrez Gene 139341 Human
  UniProt ID Q8IVP5
• Background: FUNDC1 belongs to the FUN14 family. The exact function of FUNDC1 remains unknown.
• Synonyms: MGC51029
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%