ORAI3 Rabbit Polyclonal Antibody

CAT#: TA337882

Rabbit Polyclonal Anti-ORAI3 Antibody

Product Images

WB Suggested Anti-ORAI3 Antibody; Titration: 1.0 ug/ml; Positive Control: Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ORAI3 antibody is: synthetic peptide directed towards the N-terminal region of Human ORAI3. Synthetic peptide located within the following region: GDAGEQAPLNPEGESPAGSATYREFVHRGYLDLMGASQHSLRALSWRRLY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: ORAI calcium release-activated calcium modulator 3
• Database Link:
  NP_689501
  Entrez Gene 93129 Human
  UniProt ID Q9BRQ5
• Background: ORAI3 is a key regulator or component of store-operated Ca2+ channel and transcription factor NFAT nuclear import.
• Synonyms: TMEM142C
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Rat: 86%; Mouse: 86%; Guinea pig: 86%; Rabbit: 79%

Reference Data

• Protein Families: Transmembrane